PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr038581.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRF
Protein Properties Length: 359aa    MW: 39596 Da    PI: 8.4683
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr038581.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.61.1e-2363107145
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                  d+ep+rC+RtDGKkWRCsr+v ++ k+CErH h+ r+rsrk++e+
  Pbr038581.1  63 DPEPWRCKRTDGKKWRCSRDVAPDLKYCERHAHKTRNRSRKPVES 107
                  79****************************************986 PP

2QLQ44.64.5e-16739234
          QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqa 34
                 +FTaaQ ++L++Q ++yKy++ + PvP++Ll++
  Pbr038581.1  7 PFTAAQREELERQTMIYKYMMDSSPVPSQLLLP 39
                 8******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.4E-7642IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.4E-10739IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.238742IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.17263107IPR014977WRC domain
PfamPF088791.8E-1964106IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0009941Cellular Componentchloroplast envelope
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MVNVRLPFTA AQREELERQT MIYKYMMDSS PVPSQLLLPT SKNTSNVPLV KGSLELGISG  60
SSDPEPWRCK RTDGKKWRCS RDVAPDLKYC ERHAHKTRNR SRKPVESQTP NPNFLTNNNN  120
MRSPTSNFFR QSNITNRQSS YSSNMVPCAA AAAGSHVQPR SLAWFMNGEA PAVGGSNQEW  180
GQMMQFKLGL KSSSHNYTKP TNTDVDVPRQ QTESSLNLHT DYRGEIQGVQ IQQTRHFIDA  240
WSTSTSAERE EDRVFVSPNQ KLPFSSLTLS MSGGEGSNEE RENTQMGLGV LGEERDSVGG  300
LKSQWMNPMS WTMGSPPGGP LAEALCLGIA GGSNGYNSGS TIWKSSSGDA RQEFDLTN*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009360197.10.0PREDICTED: growth-regulating factor 8
TrEMBLM5WG201e-143M5WG20_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s11480.13e-72(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF138941621
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24150.16e-41growth-regulating factor 8